Paralogue Annotation for ANK2 residue 2057

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2057
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2057

No paralogue variants have been mapped to residue 2057 for ANK2.



ANK2SIGVKKEDAAGGKEKVL------------S>H<KIPEPVQSVPEEESHRESEVPKEKMADEQG2087
ANK1------------------------------>-<------------------------------
ANK3TPVSQEEDSRPSSAQLISDDSYKTLKLLSQ>H<SIEYHDDEL--SELRGESYRFAEKMLLSEK2472
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H2057Rc.6170A>G Putative BenignSIFT: tolerated
Polyphen: benign