No paralogue variants have been mapped to residue 2085 for ANK2.
| ANK2 | -SHKIPEPVQSVPEEESHRESEVPKEKMAD>E<QGDMDLQISPDRKTSTDFSEVIKQELEDND | 2115 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | SQHSIEYHDDEL--SELRGESYRFAEKMLL>S<EK-LDVSHSDTEESVTDHAGPPSSELQGSD | 2499 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.E2085K | c.6253G>A | Putative Benign | SIFT: Polyphen: |