No paralogue variants have been mapped to residue 2087 for ANK2.
| ANK2 | HKIPEPVQSVPEEESHRESEVPKEKMADEQ>G<DMDLQISPDRKTSTDFSEVIKQELEDNDKY | 2117 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | HSIEYHDDEL--SELRGESYRFAEKMLLSE>K<-LDVSHSDTEESVTDHAGPPSSELQGSDKR | 2501 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.G2087E | c.6260G>A | Putative Benign | SIFT: Polyphen: |