No paralogue variants have been mapped to residue 2092 for ANK2.
| ANK2 | PVQSVPEEESHRESEVPKEKMADEQGDMDL>Q<ISPDRKTSTDFSEVIKQELEDNDKYQQFRL | 2122 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | HDDEL--SELRGESYRFAEKMLLSEK-LDV>S<HSDTEESVTDHAGPPSSELQGSDKRSREKI | 2506 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.Q2092R | c.6275A>G | Putative Benign | SIFT: Polyphen: |