Paralogue Annotation for ANK2 residue 21

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 21
Reference Amino Acid: Q - Glutamine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 21

No paralogue variants have been mapped to residue 21 for ANK2.



ANK2MMNEDAAQKSDSGEKFNG---------SS>Q<-RRKRPKKSDSNASFLRAARAGNLDKVVEY50
ANK1MPYSVGF---------------------->-<------READAATSFLRAARSGNLDKALDH31
ANK3MAHAASQLKKNRDLEINAEEEPEKKRKHR>K<RSRDRKKKSDANASYLRAARAGHLEKALDY60
cons                             > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q21Rc.62A>G Putative BenignSIFT:
Polyphen: benign