No paralogue variants have been mapped to residue 2132 for ANK2.
| ANK2 | DFSEVIKQELEDNDKYQQFRLSEETEKAQL>H<LDQVLTSPFNTTFPLDYMKDEFLPA----- | 2157 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | DHAGPPSSELQGSDKRSREKIATAPKKEIL>S<KIYKDVSENGVGKVSKDEHFDKVTVLHYSG | 2546 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.H2132R | c.6395A>G | Putative Benign | SIFT: Polyphen: |