No paralogue variants have been mapped to residue 2145 for ANK2.
| ANK2 | DKYQQFRLSEETEKAQLHLDQVLTSPFNTT>F<PLDYMKDEFLPA---------------LSL | 2160 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | DKRSREKIATAPKKEILSKIYKDVSENGVG>K<VSKDEHFDKVTVLHYSGNVSSPKHAMWMRF | 2559 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.F2145Y | c.6434T>A | Putative Benign | rs200115726 | SIFT: deleterious Polyphen: probably damaging |