Paralogue Annotation for ANK2 residue 2148

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2148
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2148

No paralogue variants have been mapped to residue 2148 for ANK2.



ANK2QQFRLSEETEKAQLHLDQVLTSPFNTTFPL>D<YMKDEFLPA---------------LSLQSG2163
ANK1------------------------------>-<------------------------------
ANK3SREKIATAPKKEILSKIYKDVSENGVGKVS>K<DEHFDKVTVLHYSGNVSSPKHAMWMRFTED2562
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2148Ec.6444C>A Putative BenignSIFT: tolerated
Polyphen: probably damaging
p.D2148Ec.6444C>G Putative BenignSIFT: tolerated
Polyphen: benign
p.D2148Nc.6442G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging
p.D2148Gc.6443A>G Putative BenignSIFT:
Polyphen: