No paralogue variants have been mapped to residue 2150 for ANK2.
| ANK2 | FRLSEETEKAQLHLDQVLTSPFNTTFPLDY>M<KDEFLPA---------------LSLQSGAL | 2165 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | EKIATAPKKEILSKIYKDVSENGVGKVSKD>E<HFDKVTVLHYSGNVSSPKHAMWMRFTEDRL | 2564 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.M2150V | c.6448A>G | Putative Benign | SIFT: Polyphen: |