Paralogue Annotation for ANK2 residue 2173

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2173
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2173

No paralogue variants have been mapped to residue 2173 for ANK2.



ANK2---------------LSLQSGALDGSSESL>K<NEGVAGSPCGSLMEGTPQISSEESYKHEGL2203
ANK1------------------------------>-<------------------------------
ANK3LHYSGNVSSPKHAMWMRFTEDRLDRGREKL>I<YEDRVDRTVKEAEEKLTEVSQFFRDKTEKL2602
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2173Qc.6517A>C Putative BenignSIFT: deleterious
Polyphen: benign