Paralogue Annotation for ANK2 residue 2188

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2188
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2188

No paralogue variants have been mapped to residue 2188 for ANK2.



ANK2LSLQSGALDGSSESLKNEGVAGSPCGSLME>G<TPQISSEESYKHEGLAETPETSPESLSFSP2218
ANK1------------------------------>-<------------------------------
ANK3MRFTEDRLDRGREKLIYEDRVDRTVKEAEE>K<LTEVSQFFRDKTEKLNDELQ-SPEKKA-RP2615
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G2188Ec.6563G>A Putative Benignrs185384934SIFT:
Polyphen: probably damaging