Paralogue Annotation for ANK2 residue 2252

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2252
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2252

No paralogue variants have been mapped to residue 2252 for ANK2.



ANK2QTGETKESTKTET--TTEIRSEKEHPTTKD>I<TGGSEERGATVTEDSET-------------2269
ANK1------------------------------>-<------------------------------
ANK3YSSQSPTSSSPEKVLLTELLASNDE-WVKA>R<QHGPDGQGFPKAEEKAPSLPSSPEKMVLSQ2680
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2252Tc.6755T>C Putative BenignSIFT:
Polyphen: benign