Paralogue Annotation for ANK2 residue 2266

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2266
Reference Amino Acid: D - Aspartate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2266

No paralogue variants have been mapped to residue 2266 for ANK2.

ANK2	-TTEIRSEKEHPTTKDITGGSEERGATVTE>D<SET---------------------------	2269
ANK1	------------------------------>-<------------------------------
ANK3	LLTELLASNDE-WVKARQHGPDGQGFPKAE>E<KAPSLPSSPEKMVLSQQTEDSKSTVEAKGS	2694
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.D2266H	c.6796G>C	Putative Benign			SIFT: tolerated Polyphen: benign
p.D2266V	c.6797A>T	Putative Benign			SIFT: Polyphen: