Paralogue Annotation for ANK2 residue 2274

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2274
Reference Amino Acid: F - Phenylalanine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2274

No paralogue variants have been mapped to residue 2274 for ANK2.

ANK2	--------------------------STES>F<QKEA---TLGSPKDTSPKRQDDCTGSCSVA	2301
ANK1	------------------------------>-<------------------------------
ANK3	MSSKAMPDSFSEQQAKDLACHITSDLATRG>P<WDKKVFRTWESSGATNNKSQKEKLSHVLVH	2876
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.F2274S	c.6821T>C	Putative Benign			SIFT: Polyphen: