Paralogue Annotation for ANK2 residue 2303

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2303
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2303

No paralogue variants have been mapped to residue 2303 for ANK2.



ANK2KEA---TLGSPKDTSPKRQDDCTGSCSVAL>A<KETPTGLTEEAACDEGQRTFGSSAHKT---2330
ANK1------------------------------>-<------------------------------
ANK3DKKVFRTWESSGATNNKSQKEKLSHVLVHD>V<RENHIGHPESKSVDQKNEFMSVTERERKLL2908
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2303Vc.6908C>T BenignSIFT: tolerated
Polyphen: benign