Paralogue Annotation for ANK2 residue 2345

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2345
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2345

No paralogue variants have been mapped to residue 2345 for ANK2.



ANK2QRTFGSSAHKT-----QTDSEVQESTATSD>E<TKALPLPEASVKTD---------------T2360
ANK1------------------------------>-<------------------------------
ANK3NEFMSVTERERKLLTNGSLSEIKEMTVKSP>S<KKVLYR-EYVVKEGDHPGGLLDQPSRRSES2954
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2345Kc.7033G>A Benignrs141191319SIFT:
Polyphen: benign