Paralogue Annotation for ANK2 residue 2352

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2352
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2352

No paralogue variants have been mapped to residue 2352 for ANK2.



ANK2AHKT-----QTDSEVQESTATSDETKALPL>P<EASVKTD---------------T-GTESKP2366
ANK1------------------------------>-<------------------------------
ANK3ERERKLLTNGSLSEIKEMTVKSPSKKVLYR>-<EYVVKEGDHPGGLLDQPSRRSESSAVSHIP2961
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P2352Sc.7054C>T Putative BenignSIFT: tolerated
Polyphen: benign