Paralogue Annotation for ANK2 residue 2371

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2371
Reference Amino Acid: R - Arginine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2371

No paralogue variants have been mapped to residue 2371 for ANK2.

ANK2	KTD---------------T-GTESKPQGVI>R<SPQGL----------ELALPSRD---SEVL	2388
ANK1	------------------------------>-<------------------------------
ANK3	KEGDHPGGLLDQPSRRSESSAVSHIPVRVA>D<ERRMLSSNIPDGFCEQSAFPKHELSQKLSQ	2996
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.R2371S	c.7113A>T	Putative Benign		rs181064820	SIFT: Polyphen: probably damaging
p.R2371S	c.7113A>C	Putative Benign			SIFT: Polyphen: