Paralogue Annotation for ANK2 residue 2386

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2386
Reference Amino Acid: E - Glutamate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2386

No paralogue variants have been mapped to residue 2386 for ANK2.

ANK2	VIRSPQGL----------ELALPSRD---S>E<VLSAVADDSL-------------AVS----	2399
ANK1	------------------------------>-<------------------------------
ANK3	VADERRMLSSNIPDGFCEQSAFPKHELSQK>L<SQSSMSKETVETQHFNSIEDEKVTYSEISK	3024
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.E2386K	c.7156G>A	Putative Benign			SIFT: tolerated Polyphen: probably damaging