Paralogue Annotation for ANK2 residue 2389

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2389
Reference Amino Acid: S - Serine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2389

No paralogue variants have been mapped to residue 2389 for ANK2.

ANK2	SPQGL----------ELALPSRD---SEVL>S<AVADDSL-------------AVS-------	2399
ANK1	------------------------------>-<------------------------------
ANK3	ERRMLSSNIPDGFCEQSAFPKHELSQKLSQ>S<SMSKETVETQHFNSIEDEKVTYSEISKVSK	3027
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.S2389N	c.7166G>A	Putative Benign		rs140341680	SIFT: Polyphen: probably damaging