Paralogue Annotation for ANK2 residue 2393

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2393
Reference Amino Acid: D - Aspartate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2393

No paralogue variants have been mapped to residue 2393 for ANK2.

ANK2	L----------ELALPSRD---SEVLSAVA>D<DSL-------------AVS-------HKDS	2403
ANK1	------------------------------>-<------------------------------
ANK3	LSSNIPDGFCEQSAFPKHELSQKLSQSSMS>K<ETVETQHFNSIEDEKVTYSEISKVSKHQSY	3031
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.D2393E	c.7179T>G	Putative Benign			SIFT: tolerated Polyphen: probably damaging