Paralogue Annotation for ANK2 residue 2412

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2412
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2412

No paralogue variants have been mapped to residue 2412 for ANK2.



ANK2--------AVS-------HKDSLEASPVLE>D<--NSSHKTPDSLEPSPLKESPCRDSLESSP2440
ANK1------------------------------>-<------------------------------
ANK3NSIEDEKVTYSEISKVSKHQSYVGLCPPLE>E<TETSPTKSPDSLEFSPGKESPSSDVFDHSP3070
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2412Gc.7235A>G Putative BenignSIFT:
Polyphen:
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510