Paralogue Annotation for ANK2 residue 2438

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2438
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2438

No paralogue variants have been mapped to residue 2438 for ANK2.



ANK2LED--NSSHKTPDSLEPSPLKESPCRDSLE>S<SPVEPKMKAGIFPSHFPLP-----------2457
ANK1------------------------------>-<------------------------------
ANK3LEETETSPTKSPDSLEFSPGKESPSSDVFD>H<SPIDGLEKLAPLAQTEGGKEIKTLPVYVSF3098
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S2438Nc.7313G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging