Paralogue Annotation for ANK2 residue 2446

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2446
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2446

No paralogue variants have been mapped to residue 2446 for ANK2.



ANK2HKTPDSLEPSPLKESPCRDSLESSPVEPKM>K<AGIFPSHFPLP-------------------2457
ANK1------------------------------>-<------------------------------
ANK3TKSPDSLEFSPGKESPSSDVFDHSPIDGLE>K<LAPLAQTEGGKEIKTLPVYVSFVQVGKQYE3106
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2446Rc.7337A>G Putative BenignSIFT: deleterious
Polyphen: benign