Paralogue Annotation for ANK2 residue 2458

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2458
Reference Amino Acid: A - Alanine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2458

No paralogue variants have been mapped to residue 2458 for ANK2.

ANK2	------------------------------>A<AVAKTELLTEVASVRSRLLRDPDGSAEDDS	2488
ANK1	------------------------------>-<------------------------------
ANK3	LPVYVSFVQVGKQYEKEIQQGGVKKIISQE>C<KTVQETRGTFYTTRQQKQPPSPQGSPEDDT	3152
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.A2458V	c.7373C>T	Putative Benign		rs145839325	SIFT: Polyphen: benign