Paralogue Annotation for ANK2 residue 2477

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2477
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2477

No paralogue variants have been mapped to residue 2477 for ANK2.



ANK2-----------AAVAKTELLTEVASVRSRL>L<RDPDGSAEDDSLEQTSLMESSGKSPLSPDT2507
ANK1------------------------------>-<------------------------------
ANK3QGGVKKIISQECKTVQETRGTFYTTRQQKQ>P<PSPQGSPEDDTLEQVSFLDSSGKSPLTPET3171
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L2477Rc.7430T>G Putative BenignSIFT: deleterious
Polyphen: probably damaging