Paralogue Annotation for ANK2 residue 2478

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2478
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2478

No paralogue variants have been mapped to residue 2478 for ANK2.



ANK2----------AAVAKTELLTEVASVRSRLL>R<DPDGSAEDDSLEQTSLMESSGKSPLSPDTP2508
ANK1------------------------------>-<------------------------------
ANK3GGVKKIISQECKTVQETRGTFYTTRQQKQP>P<SPQGSPEDDTLEQVSFLDSSGKSPLTPETP3172
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2478Qc.7433G>A Putative BenignSIFT:
Polyphen: probably damaging