Paralogue Annotation for ANK2 residue 2504

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2504
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2504

No paralogue variants have been mapped to residue 2504 for ANK2.



ANK2SRLLRDPDGSAEDDSLEQTSLMESSGKSPL>S<PDTPSSEEVSYEVTPKTTDVS--------T2526
ANK1------------------------------>-<------------------------------
ANK3QKQPPSPQGSPEDDTLEQVSFLDSSGKSPL>T<PETPSSEEVSYEFTSKTPDSLIAYIPGKPS3198
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S2504Fc.7511C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging