No paralogue variants have been mapped to residue 2521 for ANK2.
| ANK2 | QTSLMESSGKSPLSPDTPSSEEVSYEVTPK>T<TDVS--------TPKPAVIHECAEEDDSEN | 2543 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | QVSFLDSSGKSPLTPETPSSEEVSYEFTSK>T<PDSLIAYIPGKPSPIPEVSEESEEEEQAKS | 3215 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.T2521I | c.7562C>T | Putative Benign | rs371540452 | SIFT: deleterious Polyphen: benign |