No paralogue variants have been mapped to residue 2571 for ANK2.
| ANK2 | SENGEKKRFTPEEEMFKMVTKIKMFDELEQ>E<AKQKRDYKKEPKQEESSSSSD-----PDAD | 2596 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | AKSTSLKQTTVEETAVEREM---------->P<NDVSKDSNQRPKNNRVAYIEFPPPPPLDAD | 3263 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.E2571V | c.7712A>T | Putative Benign | SIFT: Polyphen: |