Paralogue Annotation for ANK2 residue 2578

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2578
Reference Amino Acid: Y - Tyrosine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2578

No paralogue variants have been mapped to residue 2578 for ANK2.



ANK2RFTPEEEMFKMVTKIKMFDELEQEAKQKRD>Y<KKEPKQEESSSSSD-----PDADCSVDVDE2603
ANK1------------------------------>-<------------------------------
ANK3QTTVEETAVEREM----------PNDVSKD>S<NQRPKNNRVAYIEFPPPPPLDADQ-IESDK3269
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y2578Hc.7732T>C BenignSIFT: tolerated
Polyphen: possibly damaging