Paralogue Annotation for ANK2 residue 2655

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2655
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2655

No paralogue variants have been mapped to residue 2655 for ANK2.



ANK2RKVSSSSESEPELAQLKKGADSGLLPEPVI>R<VQPPSPLPSSMD-SNSSPEEVQFQPVVSKQ2684
ANK1------------------------------>-<------------------------------
ANK3---------------LQDEHDKYQLAEPVI>R<VQPPSPVPPGADVSDSSDDESIYQPVPVKK3331
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2655Pc.7964G>C Putative Benignrs142107156SIFT:
Polyphen: probably damaging