No paralogue variants have been mapped to residue 2658 for ANK2.
| ANK2 | SSSSESEPELAQLKKGADSGLLPEPVIRVQ>P<PSPLPSSMD-SNSSPEEVQFQPVVSKQYTF | 2687 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | ------------LQDEHDKYQLAEPVIRVQ>P<PSPVPPGADVSDSSDDESIYQPVPVKKYTF | 3334 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.P2658L | c.7973C>T | Putative Benign | rs145676284 | SIFT: Polyphen: probably damaging |