Paralogue Annotation for ANK2 residue 2673

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2673
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2673

No paralogue variants have been mapped to residue 2673 for ANK2.



ANK2ADSGLLPEPVIRVQPPSPLPSSMD-SNSSP>E<EVQFQPVVSKQYTFKMNE--DTQEEPGKSE2701
ANK1------------------------------>-<------------------------------
ANK3HDKYQLAEPVIRVQPPSPVPPGADVSDSSD>D<ESIYQPVPVKKYTFKLKEVDDEQKEKPKAS3350
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2673Qc.8017G>C Putative Benignrs142652341SIFT:
Polyphen: probably damaging