No paralogue variants have been mapped to residue 2682 for ANK2.
| ANK2 | VIRVQPPSPLPSSMD-SNSSPEEVQFQPVV>S<KQYTFKMNE--DTQEEPGKSEEEKDSESHL | 2710 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | VIRVQPPSPVPPGADVSDSSDDESIYQPVP>V<KKYTFKLKEVDDEQKEKPKASAEKASNQKE | 3359 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.S2682F | c.8045C>T | Putative Benign | rs147619875 | SIFT: Polyphen: possibly damaging |