Paralogue Annotation for ANK2 residue 2689

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2689
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2689

No paralogue variants have been mapped to residue 2689 for ANK2.



ANK2SPLPSSMD-SNSSPEEVQFQPVVSKQYTFK>M<NE--DTQEEPGKSEEEKDSESHLAEDRHAV2717
ANK1------------------------------>-<------------------------------
ANK3SPVPPGADVSDSSDDESIYQPVPVKKYTFK>L<KEVDDEQKEKPKASAEKASNQKELESN-GS3365
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M2689Ic.8067G>A Putative BenignSIFT: tolerated
Polyphen: benign
p.M2689Tc.8066T>C Putative BenignSIFT: tolerated
Polyphen: benign