Paralogue Annotation for ANK2 residue 2705

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2705
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2705

No paralogue variants have been mapped to residue 2705 for ANK2.



ANK2FQPVVSKQYTFKMNE--DTQEEPGKSEEEK>D<SESHLAEDRHAVSTEAEDRSYDKLNRDTDQ2735
ANK1------------------------------>-<------------------------------
ANK3YQPVPVKKYTFKLKEVDDEQKEKPKASAEK>A<SNQKELESN-GSGKDNE-------------3370
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2705Yc.8113G>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging