Paralogue Annotation for ANK2 residue 2707

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2707
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to ANK2 residue 2707

No paralogue variants have been mapped to residue 2707 for ANK2.



ANK2PVVSKQYTFKMNE--DTQEEPGKSEEEKDS>E<SHLAEDRHAVSTEAEDRSYDKLNRDTDQPK2737
ANK1------------------------------>-<------------------------------
ANK3PVPVKKYTFKLKEVDDEQKEKPKASAEKAS>N<QKELESN-GSGKDNE---------------3370
cons                              > <                              

See full Alignment of Paralogues


Known Variants in ANK2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2707Vc.8120A>T Putative BenignSIFT: deleterious
Polyphen: benign