Paralogue Annotation for ANK2 residue 2733

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2733
Reference Amino Acid: T - Threonine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2733

No paralogue variants have been mapped to residue 2733 for ANK2.

ANK2	EKDSESHLAEDRHAVSTEAEDRSYDKLNRD>T<DQPKICDGHGCEAMSPSSSAAPVSSGLQSP	2763
ANK1	------------------------------>-<------------------------------
ANK3	EKASNQKELESN-GSGKDNE---------->-<--------FGLGLDSPQNEIAQ--------	3384
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.T2733S	c.8198C>G	Putative Benign			SIFT: tolerated Polyphen: benign