Paralogue Annotation for ANK2 residue 2734

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2734
Reference Amino Acid: D - Aspartate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2734

No paralogue variants have been mapped to residue 2734 for ANK2.

ANK2	KDSESHLAEDRHAVSTEAEDRSYDKLNRDT>D<QPKICDGHGCEAMSPSSSAAPVSSGLQSPT	2764
ANK1	------------------------------>-<------------------------------
ANK3	KASNQKELESN-GSGKDNE----------->-<-------FGLGLDSPQNEIAQ---------	3384
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.D2734H	c.8200G>C	Putative Benign		rs375718800	SIFT: tolerated Polyphen: benign