Paralogue Annotation for ANK2 residue 2735

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2735
Reference Amino Acid: Q - Glutamine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2735

No paralogue variants have been mapped to residue 2735 for ANK2.

ANK2	DSESHLAEDRHAVSTEAEDRSYDKLNRDTD>Q<PKICDGHGCEAMSPSSSAAPVSSGLQSPTG	2765
ANK1	------------------------------>-<------------------------------
ANK3	ASNQKELESN-GSGKDNE------------>-<------FGLGLDSPQNEIAQ----------	3384
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.Q2735H	c.8205G>C	Putative Benign			SIFT: Polyphen: