Paralogue Annotation for ANK2 residue 2737

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2737
Reference Amino Acid: K - Lysine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2737

No paralogue variants have been mapped to residue 2737 for ANK2.

ANK2	ESHLAEDRHAVSTEAEDRSYDKLNRDTDQP>K<ICDGHGCEAMSPSSSAAPVSSGLQSPTGDD	2767
ANK1	------------------------------>-<------------------------------
ANK3	NQKELESN-GSGKDNE-------------->-<----FGLGLDSPQNEIAQ-----------N	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.K2737E	c.8209A>G	Putative Benign			SIFT: tolerated Polyphen: benign