Paralogue Annotation for ANK2 residue 2740

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2740
Reference Amino Acid: D - Aspartate
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2740

No paralogue variants have been mapped to residue 2740 for ANK2.

ANK2	LAEDRHAVSTEAEDRSYDKLNRDTDQPKIC>D<GHGCEAMSPSSSAAPVSSGLQSPTGDDVDE	2770
ANK1	------------------------------>-<------------------------------
ANK3	ELESN-GSGKDNE----------------->-<-FGLGLDSPQNEIAQ-----------N---	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.D2740G	c.8219A>G	Unknown			SIFT: Polyphen: benign