Paralogue Annotation for ANK2 residue 2742

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2742
Reference Amino Acid: H - Histidine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2742

No paralogue variants have been mapped to residue 2742 for ANK2.

ANK2	EDRHAVSTEAEDRSYDKLNRDTDQPKICDG>H<GCEAMSPSSSAAPVSSGLQSPTGDDVDEQP	2772
ANK1	------------------------------>-<------------------------------
ANK3	ESN-GSGKDNE------------------->F<GLGLDSPQNEIAQ-----------N-----	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.H2742R	c.8225A>G	Putative Benign			SIFT: tolerated Polyphen: benign