Paralogue Annotation for ANK2 residue 2743

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2743
Reference Amino Acid: G - Glycine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2743

No paralogue variants have been mapped to residue 2743 for ANK2.

ANK2	DRHAVSTEAEDRSYDKLNRDTDQPKICDGH>G<CEAMSPSSSAAPVSSGLQSPTGDDVDEQPV	2773
ANK1	------------------------------>-<------------------------------
ANK3	SN-GSGKDNE-------------------F>G<LGLDSPQNEIAQ-----------N------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.G2743V	c.8228G>T	Putative Benign			SIFT: Polyphen:
p.G2743E	c.8228G>A	Putative Benign			SIFT: Polyphen: