Paralogue Annotation for ANK2 residue 2744

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2744
Reference Amino Acid: C - Cysteine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2744

No paralogue variants have been mapped to residue 2744 for ANK2.

ANK2	RHAVSTEAEDRSYDKLNRDTDQPKICDGHG>C<EAMSPSSSAAPVSSGLQSPTGDDVDEQPVI	2774
ANK1	------------------------------>-<------------------------------
ANK3	N-GSGKDNE-------------------FG>L<GLDSPQNEIAQ-----------N-------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.C2744R	c.8230T>C	Putative Benign			SIFT: Polyphen:
p.C2744F	c.8231G>T	Putative Benign			SIFT: Polyphen: