Paralogue Annotation for ANK2 residue 2747

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2747
Reference Amino Acid: M - Methionine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2747

No paralogue variants have been mapped to residue 2747 for ANK2.

ANK2	VSTEAEDRSYDKLNRDTDQPKICDGHGCEA>M<SPSSSAAPVSSGLQSPTGDDVDEQPVIYKE	2777
ANK1	------------------------------>-<------------------------------
ANK3	SGKDNE-------------------FGLGL>D<SPQNEIAQ-----------N----------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.M2747I	c.8241G>A	Putative Benign			SIFT: Polyphen: