Paralogue Annotation for ANK2 residue 2752

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2752
Reference Amino Acid: S - Serine
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2752

No paralogue variants have been mapped to residue 2752 for ANK2.

ANK2	EDRSYDKLNRDTDQPKICDGHGCEAMSPSS>S<AAPVSSGLQSPTGDDVDEQPVIYKESLALQ	2782
ANK1	------------------------------>-<------------------------------
ANK3	E-------------------FGLGLDSPQN>E<IAQ-----------N---------------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.S2752L	c.8255C>T	Benign		rs145895389	SIFT: Polyphen: benign