No paralogue variants have been mapped to residue 2754 for ANK2.
| ANK2 | RSYDKLNRDTDQPKICDGHGCEAMSPSSSA>A<PVSSGLQSPTGDDVDEQPVIYKESLALQGT | 2784 |
| ANK1 | ------------------------------>-<------------------------------ | |
| ANK3 | ------------------FGLGLDSPQNEI>A<Q-----------N----------------- | 3385 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.Ala2754Val | c.8261C>T | Unknown | SIFT: Polyphen: |