Paralogue Annotation for ANK2 residue 2763

Residue details

Gene: ANK2
Reference Sequences: LRG: LRG_327, Ensembl variant: ENST00000264366 / ENSP00000264366
Amino Acid Position: 2763
Reference Amino Acid: P - Proline
Protein Domain:

Paralogue Variants mapped to ANK2 residue 2763

No paralogue variants have been mapped to residue 2763 for ANK2.

ANK2	TDQPKICDGHGCEAMSPSSSAAPVSSGLQS>P<TGDDVDEQPVIYKESLALQGTHEKDTEGEE	2793
ANK1	------------------------------>-<------------------------------
ANK3	---------FGLGLDSPQNEIAQ------->-<---N--------------------------	3385
cons	> <

See full Alignment of Paralogues

Known Variants in ANK2

Protein	CDS	Disease Classification	Disease	dbSNP links	Effect Prediction
p.P2763L	c.8288C>T	Putative Benign		rs182956726	SIFT: Polyphen: benign